⚗️ For laboratory & research use only — not for human consumption.
LL37 5mg research peptide vial
Healing & Recovery

LL37 5mg

(x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes, x10 alcohol wipes)

$89 AUD · 2 variants

🔒 Secure checkout · 🚚 Free AU express over $200 · ⚗️ Research use only

⚗️ Research use only. This product is intended exclusively for in-vitro laboratory research. It is not for human or animal consumption, and is not a drug or supplement.

Choose:

LL37 5mg (x1 LL37 5mg vial)

or

LL37 5MG Starter Kit 

Everything you need to get started straight away!

(x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes,  x10 alcohol wipes)

KEY HIGHLIGHTS

  • Purity: >99% (HPLC Tested)

  • Form: Lyophilised Powder

  • Packaging: Sterile 2ml Vial

  • Intended Use: For laboratory research use only. Not for human consumption.

  • Storage: Store below 25°C, away from light and moisture.


PRODUCT OVERVIEW

LL-37 is the only known human cathelicidin peptide and is widely studied for its broad-spectrum antimicrobial and immunomodulatory activity. In research environments, LL-37 plays a significant role in innate immune response modelling, making it a popular compound for investigations into inflammation, wound biology, and cellular defence mechanisms.

Due to its multifunctional nature, LL-37 is used across a wide range of experimental models — particularly those involving tissue regeneration, microbial interaction, and immune signalling pathways.


POTENTIAL APPLICATIONS (RESEARCH ONLY)

In controlled laboratory settings, LL-37 is commonly researched for:

  • Antimicrobial activity across bacteria, fungi, and biofilm models

  • Innate immune function modelling

  • Inflammation and cytokine response studies

  • Tissue repair and wound biology mechanisms

  • Cellular defence signalling pathways

  • Skin and epithelial barrier research

Note: This compound is strictly for laboratory research. No therapeutic or medical claims are implied.


STORAGE & HANDLING

  • Store below 25°C in a dry, dark environment.

  • Keep vial sealed until use.

  • Reconstituted solutions should be handled aseptically.

  • Avoid repeated freeze–thaw cycles.


SOLUBILITY & STABILITY

LL-37 dissolves in sterile bacteriostatic water under laboratory conditions.
The peptide is sensitive to oxidation and prolonged exposure to room temperature; store reconstituted solutions appropriately to maintain stability.


TRUST & LEGITIMACY

  • COA Included: Certificate of Analysis available for each batch.

  • Lab Verified: Tested via HPLC and Mass Spectrometry.

  • Compliance: Manufactured and sold strictly for scientific, research-only use.


DISCLAIMER

This product is intended for laboratory research use only. Not for human consumption, medical use, veterinary applications, or household purposes. The purchaser assumes all responsibility for proper handling.


ATTRIBUTES

Attribute Detail
CAS Number 259061-43-9
Purity >99% (HPLC)
Appearance White Lyophilised Powder
Molecular Formula C₅₂₀H₉₇₂N₁₇₂O₁₆₇
Molecular Weight ~4493.3 g/mol
Sequence [LL-37, 37 aa]
Form Lyophilised Powder
Packaging Sterile 2ml Vial
You may also need

Related research compounds

BPC-157
Healing & Recovery

BPC-157

BPC-157 (Body Protection Compound-157) is a synthetic peptide fragment derived from a protein found in gastric juice. In laboratory research, BPC-157 is investigated for…

from$79 View
TB-500 10mg
Healing & Recovery

TB-500 10mg

TB-500 is a synthetic version of a naturally occurring peptide fragment derived from Thymosin Beta-4, a protein present in most animal and human cells. In laboratory…

from$99 View
AHK-Cu 50mg
Healing & Recovery

AHK-Cu 50mg

AHK-Cu (Ala-His-Lys: Cu2+) is a synthetically produced, high-stability copper complex neuropeptide consisting of the amino acids alanine, histidine, and lysine…

from$99 View
BPC-157 500MCG
Healing & Recovery

BPC-157 500MCG

BPC-157 is a synthetic 15-amino-acid peptide derived from a naturally occurring protective protein found in human gastric juice. In in vitro and in vivo biochemical…

$249 View
Stay in the loop

New compounds, restocks & lab results

Join the Pepreta research list for new product drops, third-party COA releases and members-only pricing. No spam — unsubscribe anytime.